This section includes 7 InterviewSolutions, each offering curated multiple-choice questions to sharpen your Current Affairs knowledge and support exam preparation. Choose a topic below to get started.
| 1. |
Fruits and vegetables are generally considered to be sources of? |
|
Answer» Explanation: Fruits and vegetables are low in FAT, salt and SUGAR. They are a good SOURCE of dietary fibre. As part of a well-balanced, regular diet and a healthy, active lifestyle, a high intake of fruit and vegetables can help you to: Reduce obesity and maintain a healthy WEIGHT. |
|
| 2. |
What is the difference between excretion and egetion? |
| Answer» | |
| 4. |
How plants prepare their food |
|
Answer» Answer: Their roots take up water and minerals from the ground and their leaves absorb a GAS CALLED carbon DIOXIDE (CO2) from the AIR. They convert these ingredients into FOOD by using energy from sunlight. This process is called photosynthesis, which means 'making out of light'. The foods are called glucose and starch. |
|
| 5. |
1 point2. Who among the following is thetackle on the football team? *O BassumOThurberO HaskinsO Bolenciecwez |
|
Answer» afsfmdgsmsgmsgsysgmsgwgamtfksegmssssg |
|
| 6. |
______ can withstand high concentration of ammonia more than 0.03% in their blood. *c. Birdsa. Monkeyb. Amphibiansd. All of these______ can withstand high concentration of ammonia more than 0.03% in their blood. * |
|
Answer» c Explanation: |
|
| 7. |
Which of the following is not a carnivorius plant |
|
Answer» Answer: |
|
| 8. |
Assertion: It is harder to make anti-viral medicine. Reason: Viruses have few blochemical mechanisms of their own. a.Both A and R are true and R is the correct explanation of assertion. b.Both A and R are true but R is not the correct explanation of assertion. c.A is true but R is false. d.A is false but R is true. |
|
Answer» Answer: a. Both A and R are true and R is the correct explanation of assertion Explanation: ➝ It is harder to make antiviral drugs rather than antibacterial ones. ➝ The basic structure of viruses are simple with a nucleic acid covered in a protein coat. ➝ Viruses lack a proper cellular organization and their own MACHINERY for metabolism. ➝ They are completely incapable of growth and reproduction outside the host cell. ➝ They UTILIZE the reproductive machinery of the host cells for their division. ➝ They are unaffected by antibiotics and can EVEN undergo mutations by making changes in their nucleic acid structure which MAKES them resistant to many drugs. ➝ They cannot reproduce outside their host cells and their multiplication involves virulent lytic phase or non virulent lysogenic phase. ➝ The infectivity of a virus is due to its nucleic acid and the specificity of a host is due to its protein coat. ➝ The nucleic acid is the only active part of the virus. ➝ The capsid, the outer protective coat protects the virus from the enzyme NUCLEASE and also helps in the transmission of the viral nucleic acid from one one host to another. ➝ Some viruses contain glycoproteins in their envelope which helps them to bind to the host surface. |
|
| 9. |
What are the orders of sub class cheatodermamorpha |
|
Answer» Answer: There are seven main taxonomic ranks: kingdom, PHYLUM or division, class, ORDER, FAMILY, GENUS, species. In addition, domain (proposed by Carl Woese) is now widely used as a fundamental rank, although it is not mentioned in any of the |
|
| 10. |
PQ full form of biology |
|
Answer» Answer: Plastoquinone (PQ) is an isoprenoid QUINONE molecule involved in the electron transport CHAIN in the light-dependent REACTIONS of photosynthesis. ... The BENZOQUINONE and isoprenyl units are both nonpolar, anchoring the molecule within the inner section of a lipid bilayer, where the hydrophobic TAILS are usually found. |
|
| 11. |
Explain the theory of lamarkism with examples |
|
Answer» Answer: HIS THEORY OFTEN CALLED THEORY OF ACQUIRED CHARACTERS OR THE THEORY OF USE AND DISUSE OF ORGANS LAMARK ARRANGED HIS THEORY IN THE FORM OF POSTULATES 1) INTERNAL FORCES TEND TO INCREASE SIZE OF THE BODY 2) FORMATION OF NEW ORGANS IS THE RESULT OF THE NEED OR WANT CONTINUOUSLY FELT BY ORGANISM 3) DEVELOPMENT AND POWER OF ACTION OF AN ORGAN IS DIRECTLY PROPORTIONAL TO IT'S USE . 4) ALL THESE CHANGES ARE ACQUIRED BY AN ORGANISM ARE TRANSMITTED TO OFFSPRING THROUGH INHERITANCE. EXAMPLES OF THIS IS : ELONGATION OF NECK IN GIRAFFE Explanation: |
|
| 12. |
Ang likas na yaman ay sandigan ng ating kinabukasan. Kung ito ay mauubos, tiyak tayo aymaaapektuhan. Ano ang maipapayo mo sa tao sa susunod na mga sitwasyon:16. Kung may barko o bangkang nangingisda na nagtatapon ng langis sa dagat.17. Kung may mga taong nagtatapon ng basura sa mga ilog at dagat.18. Kung may mga taong mahilig magsunog ng mga sirang gulong, mga winalis na basura at mga bagayna hindi na nagagamit.19. Kung may mga taong nagpuputol ng mga puno sa kapaligiran at kagubatan.20. Kung may mga magsasaka na gumagamit ng kemikal na pamatay sa kulisap sakanilangpananim. |
|
Answer» I not ABLE to UNDERSTAND the QUESTION ⁉️ SORRY |
|
| 13. |
2512. Observe the diagram andchoose the correct passage ofair in the given order of organs:PQR.litTUO(a) Pharynx, larynx, trachea , lungs,alveoli and bronchiO(b) Larynx, trachea , pharynx,alveoli, lungs and bronchi |
|
Answer» Pharynx, LARYNX, trachea , lungs, ALVEOLI and bronchi O |
|
| 14. |
What is meant by Thallopyta ..? |
|
Answer»
Thallophyta is a division of the plant kingdom including primitive forms of plant life SHOWING a simple plant body. Including unicellular to large ALGAE, fungi, lichens. The first ten phyla are REFERRED to as THALLOPHYTES. They are simple plants WITHOUT roots stems or leaves.
|
|
| 15. |
What is chlorophyll and what is it function write in detail |
|
Answer» CHLOROPHYLL is a chemical in the CHLOROPLASTS of PLANTS. It allows plants to absorb and use light. ... Chlorophyll is a green pigment in almost all plants, algae, and cyanobacteria. It absorbs light most strongly in the blue PORTION of the electromagnetic spectrum, followed by the red portion. |
|
| 16. |
Explain the conversion of hnRNA to mRNA |
|
Answer» The precursor of mRNA, i.e., HNRNA, contains both introns and EXONS. Introns are removed and exons are joined by a process CALLED SPLICING. The remaining mRNA is processed in two ways : ... When hnRNA is full processed, it is known as mRNA, which is transported out of the nucleous.
|
|
| 17. |
Read the following passage and write a reflective answer for the following questions asked below. This HW will be assessing Criteria D.An exceptional man !!Stephen Hawking developed motor neurone disease when he was in his early 20s. Most patients with the condition die within five years, and according to the Motor Neurone Disease Association, average life expectancy after diagnosis is 14 months. “Stephen Hawking is a fascinating case, and neurologists always puzzle over it. The case is fascinating because of the early onset and the length of time the disease has run,” one neurologist said.“The average duration of survival from diagnosis is about 14 months, but it varies enormously,” says Professor Nigel Leigh, professor of clinical neurology at King's College, London, and director of the King's MND Care and Research Centre. His treatment included intensive physiotherapy to loosen the muscles which kept him alive for 40 years which seems to be a medical miracle. Based on your understanding of the passage above answer the following questions: 1. Describe how the advancement of Science is applied in this scenario. 2. Choose any 1 factor ( economical or social ) and explain it in terms with the mindset of a person suffering from a neurological disorder. |
Answer» Hawking's work on black holes, quantum mechanics and the origins of the universe advanced the theories of previous thinkers like Albert Einstein and Werner Heisenberg, PROVIDING the most comprehensive explanation for the behavior of the COSMOS to date2. The specific causes of NEUROLOGICAL problems vary, but can include genetic disorders, congenital abnormalities or disorders, infections, lifestyle or environmental health problems including malnutrition, and brain injury, spinal cord injury or NERVE injury.please mark brainliest |
|
| 18. |
Q.No : 18Malvaceae hasoveryA) superiorB) inferiorC) half inferiorD) half superior |
|
Answer» inferior Explanation: The malvaceae are distinctive in being herbs,SHURBS or tress. Hope it helpplease NEED followers |
|
| 19. |
What is the function of the enzyme pepsin |
|
Answer» Answer: It digests the carbohydrate in the food It is PRESENT in our mouth Hopefully |
|
| 20. |
Q.No : 15Kidney shaped protective covering of thesorus is calledA) RachisB) pinnaC) stolonD) Indusium |
Answer» IndusiumIndusium is a PROTECTIVE kidney SHAPED covering ofsorus PRESENT in DRYOPTERIS |
|
| 21. |
What is one function of the X and Y chromosomes in humans?मनुष्य में X और Y गुणसूत्रों का एक कार्य क्या है? |
| Answer» | |
| 22. |
Hydathodes are what's glands are called |
|
Answer» Answer: HENCE, HYDATHODES are ALSO called as 'chalk GLANDS'. . Hope it HELPS yah!! |
|
| 23. |
38. In the sketch diagram given below P, Q, R and Sare blood vesselsLungsHeartBody partsIdentify the blood vessels which are carryingoxygenated blood and deoxygenated blood.Blood vesselscarryingoxygenated bloodBlood vesselscarryingdeoxygenatedbloodP and oR and S(1)(2)(3)P and RO and SO and SP and RO and RP and S |
|
Answer» WHERE IS THE SKETCH |
|
| 24. |
Hydathodes are also called as what? |
|
Answer» WATER Stomata Explanation: Hydathodes are also called water stomata through which guttation occurs. The term stomata is a misnomer, because stomata is an OPENING, which can be regulated but the opening in hydathodes cannot be regulated. Hydathodes are the MODIFIED PORES at the MARGIN or tip of the leaves. |
|
| 25. |
Gawin Ang akrostik sa ibaba. Magbigay ng mha salita na kaugnayan ng aralin sa modyul na ito. Gawin mo ito sa iyong sagutang papel.K -A -P -A -Y -A -P -A -A -N -don't answer if you don't know what the answeroh and I'm going to new york again! |
| Answer» | |
| 26. |
Which part of our body does not grow from our childhood? |
|
Answer» The only part of the human body which does not grow in size from BIRTH to DEATH is the 'innermost ear OSSICLE' or the 'STAPES'. EXPLANATION: The stapes is 3 mm is size when a person is born. As a person grows or develops, this ossicle does not grow in size. |
|
| 27. |
What type of acid in grow of breast ?स्तन बढ़ने में किस प्रकार का अम्ल होता है ? |
|
Answer» Folic acid supplements at levels consumed by breast cancer PATIENTS and survivors in North America promoted the growth of EXISTING breast cancer in rats, new research found. The ROLE of FOLATE, a B vitamin, and its SYNTHETIC form, folic acid, in the development and progression of breast cancer is highly controversial. |
|
| 28. |
Our population which was approximately 350 million at the time of our independence reached close to the billion mark by 2000 and crossed 1.2 billion in may 2011 . mention the probable reasons for this. |
|
Answer» Answer: Two reasons for increase in population are: i A rapid decline in death rate MATERNAL mortality rate and infant mortality rate. ii Increase in number of people in reproducible age.Two reasons for decline in population are: i Statutory raising of marriageable age of the FEMALE to 18 years and male to 21 years. ii INCENTIVES GIVEN to COUPLES with small families. Explanation: please mark my answer as brainlist answer |
|
| 29. |
The plant that floats on the surface water completely is : a)Hydrilla b)pistia c) lotus d)none |
|
Answer» Answer: Aquatic Plants
Aquatic plants are those which LIVE in or on the water. Aquatic plants are also called hydrophytic plants. These plants have evolved special features like air SACS for flotation, increased number of stomata, smaller feathery and specialized roots to take in OXYGEN. Aquatic plants are of THREE main types. Explanation: PLEASE mark as brainllist |
|
| 30. |
Desert plants and animals are suited to : a)dry conditions b)vast temperature differences c)both A&B d)none |
|
Answer» Answer: Explanation: |
|
| 31. |
Which among the following is (are)aquatic habitat(s) a)rivers b)lagoons c)swamps d)all the above |
Answer» All of the above |
|
| 32. |
9.10.Mention four species of Cinchona bark. |
|
Answer» Explanation: The four SPECIES are CINCHONA officinalis, Cinchona succirubra, Cinchona ledgeriana and Cinchona Carlisle hope this HELPS to yo |
|
| 33. |
Very few students are so dever as ramesh(change in to comparative degree |
| Answer» | |
| 34. |
Name three genetic disorders that can be identified based on amniocentesis. |
|
Answer» MULTIPLE ANSWERS AND MULTIPLE THANKER ❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤❤ |
|
| 35. |
Fill in the blanks :(1) Yellow colour of turmeric is due to the presence of |
|
Answer» turmeric is a MIX of CHEMICAL compounds, but its bright yellow colour is DUE to the presence of a particular compound: CURCUMIN |
|
| 36. |
In a betelnut tree initially huge nuts formation take place and gradually the tree grows no nuts .Why? |
|
Answer» It is a palm tree SPECIES under the family of Arecaceae. It has COMMERCIAL and economic importance not only in India but also in China and Southeast Asia.The areca NUT is the SEED of the areca palm (Areca catechu), which grows in much of the tropical Pacific ( Melanesia and MICRONESIA), Southeast and South Asia, and parts of east Africa. |
|
| 37. |
Name two STIs which are not completely curable. |
|
Answer» Answer: Of these 8 infections, 4 are CURRENTLY curable: syphilis, gonorrhoea, chlamydia and TRICHOMONIASIS. The other 4 are viral infections which are incurable: hepatitis B, herpes SIMPLEX VIRUS (HSV or herpes), HIV, and human papillomavirus (HPV). Explanation: PLEASE MARK ME AS BRAINLIST |
|
| 38. |
Question:-Explain about fluid connective tissue |
|
Answer» Blood is a fluid CONNECTIVE tissue, a variety of specialized cells that circulate in a watery fluid containing salts, nutrients, and dissolved proteins in a LIQUID extracellular matrix. Blood contains FORMED elements derived from bone marrow. ◦•●◉✿Hope it helps you ✿◉●•◦ ◦•●◉✿Have a GREAT day✿◉●•◦ |
|
| 39. |
What does the term niche denoteswrite any two slogans of rain water harvesting |
|
Answer» Explanation: Q. what does the term niche denotes ? In ecology, a niche is a SPECIES' match to a particular environmental situation. ... It explains how the DISTRIBUTION of resources and competitors reacts to an organism or population and how it affects those same variables in turn. Q . write any TWO slogans of rain water harvesting ☆ Don't let rain water run away, let it run to the EARTH again. ☆ Don't make earth devoid of water, just save rain water. ☆ Don't waste even a drop of water, make earth rich of water. ☆ Every drop in the ocean counts. |
|
| 40. |
What does the term niche denotes |
|
Answer» Explanation: In ECOLOGY, a niche is a SPECIES' match to a particular ENVIRONMENTAL situation. ... It explains how the distribution of resources and competitors reacts to an organism or POPULATION and how it affects those same variables in TURN. |
|
| 41. |
1. What are Voluntary Muscles |
|
Answer» Voluntary MUSCLES are the muscles that are under conscious control and can be controlled at will or we can CHOOSE when to use them. They are also known as skeletal muscles as they are ATTACHED to the bones. Voluntary muscles are responsible for the movement of BODY parts and the locomotion. Explanation: I hope it's helpful for you. |
|
| 42. |
9Men to the 224 yearde of the end of the 2 year=209261Benguenlernes = 11/16 - 1959) - * ISK1969/year in the dateres?171106 CL to the 20 )(tax the W year = CL of the 2nd year lat, onIAVEL |
|
Answer» Intergalactic gas is so tenuous that it EMITS no light of its own. ... Instead astronomers STUDY it indirectly by observing how it selectively absorbs the light COMING from faraway sources KNOWN as quasars. |
|
| 43. |
3) A certain sum amounts to * 5,292 in twoyears and * 5,556.60 in three years, interestbeing compounded annually. Find:(i) the rate of interest |
|
Answer» INTERGALACTIC gas is so tenuous that it emits no light of its own. ... INSTEAD astronomers study it indirectly by observing how it selectively ABSORBS the light coming from FARAWAY SOURCES known as quasars. |
|
| 44. |
92. M/J 14/P12/Q19Diploid (2n) organisms that reproduce sexually produce haploid (n) gametes.Some plants, such as wheat, can produce diploid or haploid gametes. These gametes canfertilise other diploid or haploid gametes.Which statements are correct for plants like these?1 Diploid gametes may be produced by a fault in the reduction division (meiosis).X2 The offspring will always show an increased chromosome number.3 The offspring could be either 2n, 3n or 4n.4 The chromosome number could, in theory, increase with each generation.А 1, 2 and 3B 1, 2 and 4C 1, 3 and 4D 2, 3 and 4 |
|
Answer» Answer: 1. False 2. True 3. 4n 4. B - 1,2 and 4. Explanation: 1. There can be no fault. 2. It will show an increase in CHROMOSOME number because the male GAMETE has 23 chromosomes, the female having the same number.. Which will increase the no. of chromosomes in the offspring's making it 46. 3. Meiosis involves the DIVISION of cells to 4n whereas mitosis, to 2n. In this case, it is meiosis 4. 1,2 and 4 where meiosis is taking place. Hope it helps, Mark BRAINLIEST if it HELPED you.. |
|
| 45. |
Describe the adaptation of small intestine to its function(20mks) |
|
Answer»
Answer :-The small intestines are well adapted for absorbing nutrients during digestion by: being very long, having villi and MICROVILLI that increase surface AREA, USING muscular contractions to move and mix food, and receiving and housing digestive enzymes and bile that HELP the breakdown of food. |
|
| 46. |
Is there any difference in the composition of the cell walls of plants living in different habitats? |
|
Answer» Explanation: The primary cell wall provides flexible structure and support as PLANT CELLS grow and divide. The secondary cell wall appears when the plant cell has finished growing to SUPPLY rigid support. A bacterial cell wall protects the cell from BURSTING and from ATTACK and contamination. |
|
| 47. |
What's is ATP(Adenosine Triphosphate) |
|
Answer» Answer: ADENOSINE 5'-triphosphate, or ATP, is the PRINCIPAL MOLECULE for storing and transferring energy in cells. ... ATP is a nucleotide consisting of an adenine base attached to a ribose sugar, which is attached to THREE PHOSPHATE groups. |
|
| 48. |
Reasons for Mendel's Success |
|
Answer» The main reason for the success of Mendel was that he TOOK one character at one time in his EXPERIMENTS of hybridization. So it was easy. Other scientists ALSO performed cross-hybridization for many characters, this made the experiments COMPLEX and they could not accurately EXPLAIN the results. |
|
| 49. |
How sex is determined in reptiles? How can we identify whether it is male or female by phenotype? |
|
Answer» Answer: MALES R more swollen at the base of the tail than females and have a pair of ENLARGED scales NEAR their cloaca.... |
|
| 50. |
¿A qué se llama frecuencia génica? |
|
Answer» La frecuencia alélica ES simplemente proporciones de cada alelo (diferentes versiones de un GEN) dentro de una población. La frecuencia de LOS alelos puede dar alguna indicación sobre qué versión del gen (alelo) proporciona la mayor ventaja adaptativa. La frecuencia de los alelos se puede calcular contando el número de cada alelo y convirtiéndolos en porcentajes. Por ejemplo, para la población representada por encima de la frecuencia del alelo A (dominante) se puede calcular de la siguiente manera: No.of dominant Allele/total no.of ALLELES *100 |
|